Loading...
Statistics
Advertisement

Nimen.com

Advertisement
Conversion Technology Metas Server
Nimen.com is hosted in Canada / Toronto . Nimen.com uses HTTPS protocol. Number of used technologies: 1. First technologies: Html, Number of used javascripts: 0. Number of used analytics tools: 0. Its server type is: Apache/2.2.29 (Unix) mod_ssl/2.2.29 OpenSSL/0.9.8e-fips-rhel5 mod_bwlimited/1.4.

Technologies in use by Nimen.com

Technology

Number of occurences: 1
  • Html

Advertisement

Server Type

  • Apache/2.2.29 (Unix) mod_ssl/2.2.29 OpenSSL/0.9.8e-fips-rhel5 mod_bwlimited/1.4

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Not founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Nimen.com

SSL certificate

    • name: /OU=Domain Control Validated/OU=PositiveSSL/CN=sb3.cmh.net
    • subject:
      • OU:
        • 0: Domain Control Validated
        • 1: PositiveSSL
      • CN: sb3.cmh.net
    • hash: 1fd77b16
    • issuer:
      • C: GB
      • ST: Greater Manchester
      • L: Salford
      • O: COMODO CA Limited
      • CN: COMODO RSA Domain Validation Secure Server CA
    • version: 2
    • serialNumber: 225867184325275899676807533193415250150
    • validFrom: 150226000000Z
    • validTo: 180225235959Z
    • validFrom_time_t: 1424908800
    • validTo_time_t: 1519603199
    • extensions:
      • authorityKeyIdentifier: keyid:90:AF:6A:3A:94:5A:0B:D8:90:EA:12:56:73:DF:43:B4:3A:28:DA:E7
      • subjectKeyIdentifier: 81:AC:BC:77:1E:0F:23:E9:8D:8F:65:7B:B8:F0:D6:19:00:34:36:FA
      • keyUsage: Digital Signature, Key Encipherment
      • basicConstraints: CA:FALSE
      • extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
      • certificatePolicies: Policy: 1.3.6.1.4.1.6449.1.2.2.7 CPS: https://secure.comodo.com/CPS Policy: 2.23.140.1.2.1
      • crlDistributionPoints: Full Name: URI:http://crl.comodoca.com/COMODORSADomainValidationSecureServerCA.crl
      • authorityInfoAccess: CA Issuers - URI:http://crt.comodoca.com/COMODORSADomainValidationSecureServerCA.crt OCSP - URI:http://ocsp.comodoca.com
      • subjectAltName: DNS:sb3.cmh.net, DNS:www.sb3.cmh.net

Meta - Nimen.com

Number of occurences: 0

Server / Hosting

  • IP: 64.34.180.98
  • Latitude: 43.60
  • Longitude: -79.54
  • Country: Canada
  • City: Toronto

Rname

  • ns1.cmhinet.com
  • ns2.cmhinet.com
  • ns3.cmhinet.com
  • cmheleu.cmh.net

Target

  • operator.sb3.cmh.net

HTTP Header Response

HTTP/1.1 200 OK Date: Sun, 08 May 2016 18:14:55 GMT Server: Apache/2.2.29 (Unix) mod_ssl/2.2.29 OpenSSL/0.9.8e-fips-rhel5 mod_bwlimited/1.4 Last-Modified: Tue, 24 Jul 2007 16:10:13 GMT ETag: "2fa805d-132-43604a0d62340" Accept-Ranges: bytes Content-Length: 306 Content-Type: text/html X-Cache: MISS from s_xt40 X-Cache-Lookup: MISS from s_xt40:80 Via: 1.1 s_xt40 (squid/3.5.14) Connection: keep-alive

DNS

host: nimen.com
  1. class: IN
  2. ttl: 1440
  3. type: A
  4. ip: 64.34.180.98
host: nimen.com
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns1.cmhinet.com
host: nimen.com
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns2.cmhinet.com
host: nimen.com
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns3.cmhinet.com
host: nimen.com
  1. class: IN
  2. ttl: 86400
  3. type: SOA
  4. mname: ns1.cmhinet.com
  5. rname: operator.sb3.cmh.net
  6. serial: 2015061600
  7. refresh: 86400
  8. retry: 7200
  9. expire: 3600000
  10. minimum-ttl: 86400
host: nimen.com
  1. class: IN
  2. ttl: 1440
  3. type: MX
  4. pri: 10
  5. target: cmheleu.cmh.net
host: nimen.com
  1. class: IN
  2. ttl: 1440
  3. type: TXT
  4. txt: v=spf1 ip4:64.34.180.98 mx ~all
  5. entries: Array

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.imen.com, www.nnimen.com, www.nimen.com, www.nhimen.com, www.himen.com, www.njimen.com, www.jimen.com, www.nkimen.com, www.kimen.com, www.nlimen.com, www.limen.com, www.n imen.com, www. imen.com, www.nmen.com, www.nirmen.com, www.nrmen.com, www.nifmen.com, www.nfmen.com, www.nivmen.com, www.nvmen.com, www.nikmen.com, www.nkmen.com, www.ni,men.com, www.n,men.com, www.nibmen.com, www.nbmen.com, www.nigmen.com, www.ngmen.com, www.nitmen.com, www.ntmen.com, www.niymen.com, www.nymen.com, www.niumen.com, www.numen.com, www.nijmen.com, www.njmen.com, www.nimmen.com, www.nmmen.com, www.ninmen.com, www.nnmen.com, www.nien.com, www.nimpen.com, www.nipen.com, www.nimoen.com, www.nioen.com, www.nimien.com, www.niien.com, www.nimken.com, www.niken.com, www.nim.en.com, www.ni.en.com, www.nimuen.com, www.niuen.com, www.nimjen.com, www.nijen.com, www.nimnen.com, www.ninen.com, www.nim-en.com, www.ni-en.com, www.nimn.com, www.nimexn.com, www.nimxn.com, www.nimesn.com, www.nimsn.com, www.nimewn.com, www.nimwn.com, www.nimern.com, www.nimrn.com, www.nimefn.com, www.nimfn.com, www.nimevn.com, www.nimvn.com, www.nimecn.com, www.nimcn.com, www.nimeqn.com, www.nimqn.com, www.nimean.com, www.niman.com, www.nimeyn.com, www.nimyn.com, www.nime.com, www.nimenn.com, www.nimen.com, www.nimenh.com, www.nimeh.com, www.nimenj.com, www.nimej.com, www.nimenk.com, www.nimek.com, www.nimenl.com, www.nimel.com, www.nimen .com, www.nime .com,

Other websites we recently analyzed

  1. nancykhawamfamilylawandmediation.org
    United Kingdom - 81.21.76.62
    Server software: Apache/2.2.3 (CentOS)
    Technology: CSS, Html, Javascript, Php
    Number of Javascript: 1
    Number of meta tags: 1
  2. Home - RSM Connect - Breitband für das Berchtesgadener Land und Landkreis Traunstein
    Germany - 80.255.15.136
    Server software: Apache/2.2.15 (Unix) DAV/2 mod_fcgid/2.3.6-dev SVN/1.6.11
    Technology: CSS, Html, Html5, Javascript
    Number of Javascript: 4
    Number of meta tags: 3
  3. Immobilier Dompierrois
    France - 195.154.216.236
    Server software: Apache/2.4.9 (Win64) PHP/5.5.12
    Technology: CSS, Google Font API, Html, Iframe, Javascript, Php, Swf Object, Google Analytics
    Number of Javascript: 1
    Number of meta tags: 1
  4. PSD to Responsive HTML5 & CSS - Slice PSD - Save 40% on every order
    Pixel perfect PSD to HTML5 and CSS converting services: PSD to Email, WordPress, Magento, global coding standards, world class quality at great prices. Full money back guarantee.
    Lansing (United States) - 50.28.14.165
    G Analytics ID: UA-55736473-1
    Server software: Apache/2.2.29 (Unix) mod_ssl/2.2.29 OpenSSL/1.0.1e-fips mod_bwlimited/1.4
    Technology: CSS, Html, Html5, Javascript, SuperFish, Zopim Live Chat, Google Analytics
    Number of Javascript: 3
    Number of meta tags: 4
  5. BM Scavi
    Arezzo (Italy) - 62.149.144.108
    G Analytics ID: UA-65976169-1
    Server software: Apache
    Technology: Carousel, CSS, Html, Html5, Javascript, jQuery, jQuery Fancybox, Php, Pingback, SVG, Google Analytics, Wordpress
    Number of Javascript: 11
    Number of meta tags: 4
  6. Ear Mitts Ear Muffs - Bandless Ear Muffs Ear Warmers
    Earz and Ear Mitts Bandless Ear Muffs area stylish way to keep your ears protected from the wind and cold. Their unique patented design works for anyone. ONE SIZE FITS ALL! A perfect gift idea!
    Frisco (United States) - 64.251.203.56
    G Analytics ID: UA-42780856-1
    Server software: Microsoft-IIS/6.0
    Technology: CSS, Html, Javascript, Google Analytics
    Number of Javascript: 4
    Number of meta tags: 4
  7. ### Sanitätshaus Koeppe, Wald-Apotheke, Westend-Apotheke Eberswalde ###
    Die Wald-Apotheke, Westend-Apotheke und das Sanitätshaus Koeppe versorgen Pflegeeinrichtungen, Krankenhäuser und Arztpraxen mit Medikamenten und medizinischem Bedarf. Wir liefern innerhalb Eberswalde kostenlos zu Ihnen.
    Germany - 217.160.123.26
    Server software: Apache
    Technology: CSS, Php
    Number of meta tags: 7
  8. zzhy888.com
    San Jose (United States) - 69.46.84.52
    Server software: Tengine/1.4.2
    Technology: CloudFront, Google Adsense, Html, Javascript, Php
    Number of Javascript: 2
    Number of meta tags: 1
  9. watchmenforzion.org
    Scottsdale (United States) - 184.168.221.53
    Server software: Microsoft-IIS/7.5
    Technology: Html, Html5, Iframe
  10. jgwentworthsucks.com
    Scottsdale (United States) - 184.168.167.1
    Server software: Apache
    Technology: Html

Check Other Websites